PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G18710.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 330aa    MW: 35447.9 Da    PI: 7.8154
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G18710.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.61.7e-15260303548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  L++eN++Lkk+
  OPUNC05G18710.5 260 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLKEENERLKKQ 303
                      79***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.4E-10256312IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.565258303IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.94E-11260305No hitNo description
PfamPF001704.9E-13260303IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-14260308No hitNo description
CDDcd147071.72E-26260307No hitNo description
PROSITE patternPS000360263278IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MIQAMASHAG GSGGGGGRDA SSAQRGPIQG LVKQGSLYGL TLNEVQSQLG EPLLSMNLDE  60
LLKSVFPDDT DPDSGGGVSG QSQVALGLQR QGSITMPPEL SKKTVDEVWK GIQDVPKRGA  120
EEGGRRRRER QPTLGEMTLE DFLVKAGVVT DPNDLPGNMD MVGGAAAAAA ADTSDLNAGA  180
QWLQQYHQQA LEPQHPSIAA PYMASHLAPQ PLAVATGAVL DPIYSDGQIT SPMLGALSDP  240
QTPGRKRGAT GEIADKLVER RQKRMIKNRE SAARSRARKQ AYTNELENKV SRLKEENERL  300
KKQKELDEIL NSAPPPEPKY QLRRTRSAAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123130GRRRRERQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0633980.0AK063398.1 Oryza sativa Japonica Group cDNA clone:001-114-H11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638733.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES32e-88AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0E0L4320.0A0A0E0L432_ORYPU; Uncharacterized protein
STRINGLOC_Os05g41070.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-81ABA-responsive element binding protein 3